PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_014026
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family SBP
Protein Properties Length: 540aa    MW: 59687.2 Da    PI: 8.1757
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_014026genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP134.63.1e-42177252277
                  -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
          SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                  Cqv gC++dls++k+yh+rhkvCevhsk+p+v+v+g+eqrfCqqCsrfh l efD++krsCr+rLa+hnerrrk++
  DCAR_014026 177 CQVYGCKKDLSSCKDYHKRHKVCEVHSKTPKVIVNGIEQRFCQQCSRFHLLVEFDDGKRSCRKRLAGHNERRRKPH 252
                  **************************************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.0E-34173238IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.898174251IPR004333Transcription factor, SBP-box
SuperFamilySSF1036125.76E-39175255IPR004333Transcription factor, SBP-box
PfamPF031103.5E-31177250IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 540 aa     Download sequence    Send to blast
MESWSYVSGE RGFVSEDSDV IARGRNGAMD WEFKSPFYGS HNNDNNVGLG SSSQEGIENM  60
GILDLGHQET LRKSISNGSI KDALGTKLSG VRMFNSLAEN AFWGEEEPSA KLPSSIMDFN  120
SADSSLIDLK LGRFDDQRDV QKLPSSRVAP NIYSNDTVSV TGKRTRVGGL NSLTPYCQVY  180
GCKKDLSSCK DYHKRHKVCE VHSKTPKVIV NGIEQRFCQQ CSRFHLLVEF DDGKRSCRKR  240
LAGHNERRRK PHAGIHSVRS RLYPTYNNVG RFQETTVSTS SFIRQDVLPG YLSQPQKLAS  300
NDYWSKHIKL EEADNYSSQS AITVAGGGFH PRSHFPSYGF DKHCLSTDRN GIYHMSESKS  360
SKNSNLFRNA SSGSETFTGF DSPLTVQALS GFPDSGRALS LLSSQSQTSS SHTSGILMAY  420
PLIIPGSHEH YTVNQVSEKP LGLSPQVSKN EISNKFISSG MNSAENHLNR MITTSGSNAV  480
VSYGIDGMFH GSNYINGGKE HLSCGDEPTI DMLQLSSQLQ RVEDQRQSLH EKPRNDSFL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A9e-291772501184squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010663471.11e-164PREDICTED: squamosa promoter-binding-like protein 6 isoform X3
TrEMBLF6GTE31e-164F6GTE3_VITVI; Putative uncharacterized protein
STRINGVIT_17s0000g05020.t011e-164(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51871639
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.12e-45SBP family protein